List of proxy sites. There are several ways to access the RARBG torrent site.
List of proxy sites 6 days ago · Both Proxy Lists and Proxy Sites offer Proxy Servers. Aug 3, 2022 · This allows you to access blocked websites, as the traffic is flowing through the unblocked proxy server instead. Export to txt, csv, or API. Using proxy sites is considered a safe and fast option Dec 9, 2024 · 5. org Here’s a list of 123Movies proxy sites that we have hand-picked over the internet. Bright Data 6 days ago · Part 2. Oct 14, 2024 · Proxy services, sometimes referred to simply as proxies, operate as a type of identification shield between your device and the open internet. I regularly update my list of live (master and mirror) torrent ProxySites is #1 Proxy aggregator, Discover and access over 200+ analyzed proxy sites and tools, updated daily and trusted by over 13,000 users. 1337x Torrents was closed several times and had to move to avoid legal problems. All the 123Movies mirror and proxy sites can be opened directly in your browser. Whether you’re browsing, streaming, or scraping, these proxies are ready to meet your needs. i. ), server location, IP addresses, and so on. We don't allow proxies hosted on free domains to be submitted to our proxy list. Fresh Proxy List — One of the Most Feature-Rich Proxy Lists. Nov 5, 2024 · Here is a list of updated and verified proxy sites for FMovies that are currently working. Nov 1, 2020 · Our list of the top torrenting websites would be incomplete without mentioning MyAnonaMouse. Oct 30, 2024 · Secure Browsing: Unblocked proxy sites, particularly those that offer HTTPS encryption, can secure user data, making it difficult for hackers or ISPs to monitor your activities. Site Country Feb 18, 2025 · Some providers offer a list of free proxy servers that users can access as needed. We check the proxy links every week to ensure they are working properly. Using a proxy site is straightforward: Open the URL of the proxy site. Rather than routing your traffic, activity, and Jan 31, 2025 · The Pirate Bay’s database has been replicated across numerous proxy and mirror sites, allowing users to bypass restrictions and access their desired content. to; https://1337x. If you are looking for a reliable and trustworthy torrent site that will give you downloadable content, you should not look further than the Pirate Bay Network. Updated List of Torlock Proxy and Mirror Sites 2025. Below is an updated list of working 1337x proxy sites in 2025. Our web proxy is free and supports the most popular websites, such as YouTube, Google, Facebook, Twitter, and adult entertainment websites. Rotating Pro (11840 IP) Rotating Open (371 IP) Feb 20, 2025 · Find Reliable and Trusted Private Proxy List - Private proxies are like best dedicated proxies which are secure, anonymous, and for high-speed internet access. Moreover, these proxy sites are 100% tested and found not to be banned in most countries. A free alternative to VPN! 5 hours ago · PIC: Best RARBGs list. In comparison, BlockAway is free and doesn't require any configuration. Below we have listed the best free proxy sites: HideMyAss; Sitenable; VPNBook; kProxy; Privoxy; New Ip Now; Blaze Proxy; Xite Now; 24 Tunnel; FibreProx; SudoProxy; Video Proxy; Unblock Video Sites; Free Anonymous proxy Site; My-Proxy; Youku; SSL Secure Proxy; Proxy GIZLEN; Prox Free; Nqma Me Hide; Online Proxy 3 days ago · This list of working Pirate Bay proxy sites was last updated on Sat Mar 15 2025 05:02:41 GMT+0000 (Coordinated Universal Time), so be sure to bookmark the page for the latest updates. Here’s an in-depth analysis of the best proxies in 2025: 1. Several online platforms categorize and curate lists tailored for educational settings. 42 per IP. It is free, you can try this online proxy right now! Jan 25, 2025 · Here’s a list of working EZTV mirror and proxy sites to unblock EZTV torrent websites in any region. - fyvri/fresh-proxy-list Jan 27, 2025 · Comprehensive List of Active 1337x Proxy Sites. Feb 6, 2025 · The best proxy sites from the biggest brands - Smartproxy and Oxylabs proxy servers from just $0. These platforms offer similar features, including a wide selection of movies and TV shows, and are often updated with the latest content. The website is one of the most popular private torrent clients for reading eBooks. Unblock sites, browse anonymously, and enhance online privacy. Here’s a list of some of the best free online web proxy sites to help you bypass restrictions and browse the internet freely: HideMyAss (HMA) Web Proxy User-friendly interface Supports HTTPS encryption Allows you to choose Limetorrents Proxy is one of the most popular sites that allows you to download everything you need. HideMyAss offers a free proxy service alongside its renowned VPN services. There are quite a few proxy sites that you can use. Feb 25, 2025 · These free proxy sites let you unblock all the geo-blocked content without hassle. Mar 10, 2025 · The Need for Proxies and Mirrors; List of Active KickAss Proxies and Mirrors in 2025; Steps to Access KAT Using Proxies; Other Torrent Proxy Resources We have carefully selected the following collection of MagnetDL online proxy sites. 4 days ago · Looking for the best TorrentGalaxy proxy list, mirror sites, and alternatives? Here are the best TorrentGalaxy proxy sites to download torrents for movies, games, music, and apps for free. How I Built My Own Todo List App in Minutes Using AI Tools. Feb 17, 2025 · A proxy must work for your use case and offer a failsafe when it doesn’t. You can also be anonymous by using them. In this section, I have collected the most popular torrents with the highest number of peers and seeds. ProxyScrape is a great option for free proxy lists. If any of these extratorrent proxies are not working for you then simply try the other. If you're looking for a secure and functional proxy, this list provides the best options available. See full list on softwaretestinghelp. The best proxy services provide a host of additional features and APIs, rapidly accelerating the development process and reducing the need to maintain your scripts or applications. The process involves a few straightforward steps: Select an Appropriate Proxy Begin by choosing one of the proxy sites from the list above. Well indexed content where you can easily find everything and even links. eu; https://x1337x. Best Chrome VPN extension of 2025. Browser your Content: The web proxy site should function like TamilMV, use the search bar from the top right corner to find your favorite content. The best free VPN in 2025. Dec 5, 2024 · Updated 1337x Proxy Sites (2025) Proxy sites are intermediary platforms that allow users to access blocked websites by rerouting their requests. All the URLs are sourced from different parts of the Internet and are found to be working. Note: I've personally tested all these proxies. We only list popular and working web proxy sites and check them from time to time. Most of these are working proxies, but if it doesn’t work, try using a different proxy site from the list below. e, The VPN. Feb 17, 2023 · Extratorrent Proxy List 2025: Mirror Sites & Safe Alternatives [Working] #Proxy websites #The Pirate Bay #torrents. These proxy sites will help you unblock TorrentGalaxy on all devices. Each site offers access to the same content available on the original platform, making them reliable alternatives for users facing restrictions. Before using a proxy on your school device, consider the following advantages and disadvantages: Pros Pirate Bay is a famous and popular file-sharing website utilizing the BitTorrent protocol. These are 100% working proxy of extratorrents that will help you access it effortlessly. abcproxy. Pirate Bay Proxy List Unblockit - Access your favorite sites like The Pirate Bay, 1337x, YTS, and Primewire easily. Proxy Site. Jan 31, 2025 · Where to Locate Trustworthy School Proxy Lists. Rotating Pro (11811 IP) Rotating Open (495 IP) Http List (301 IP) Open Proxy List is your one-stop destination for accessing a wide variety of free proxy and VPN servers from around the world. Legal platforms like Netflix, Amazon Prime Video, and Aha offer affordable, high-quality streaming without compromising your security or ethics. Private residential proxies provide exclusive, dedicated IP addresses that ensure enhanced security, anonymity, and speed for various online activities such as web scraping, sneaker copping, social media automation, and accessing geo Free proxy for any device. com The first step to access any blocked site is through a proxy site. Feb 2, 2025 · For users interested in utilizing proxy sites to access TamilMV, a systematic approach can ensure a smoother experience. That is it! These were the 20 best RARBG mirror and proxy sites available with easy access. Here is a list of the 1337x torrent proxy sites. It has a lot of files available in categories that include unique content Here are the list of best 1000+ and top 50 proxies for your school to unblock almost every websites and games without any hassle. The leading torrenting sites continue to 1337x proxies are web proxies specifically designed to connect to 1337x torrents or other torrent sites. Websites like AddictiveTips offer recommendations. Feb 25, 2025 · Choose your favorite Proxy: Choose any proxy or mirror site from the above list; Open in Browser: Copy and paste the web address to access the website without a VPN. For that reason, we’ve included several options so that you can try each one. However, it cannot be guaranteed that these proxy sites will work for Full unblocked proxy list on unblockninja. Surf anonymously with full video streaming support, no config required. Feb 26, 2025 · With a list of working 1337x proxies and mirrors, this guide explores the use of 1337x proxy sites and mirror sites as 1337x alternatives to access the popular torrent platform 1337x when it is blocked or restricted. Below, we explore some of the best free online web proxy sites that help you unblock websites. These proxies are designed to provide uninterrupted access to FMovies’ extensive library while ensuring a seamless streaming experience: Nov 27, 2023 · Best torrent sites that work in 2025. Feb 21, 2025 · Discover the 10 best free proxy servers in 2025. Top 100+ 1337x Proxy and Mirror Sites (April 2025) Dec 13, 2024 · Reliable Alternatives to FMovies. Top 7 Unblocked Proxy Sites. On the other hand, there are also Rotating Proxy sites. However, many VPN services are paid and designed for professional usage. All the proxy sites mentioned in the list are Jan 19, 2025 · Benefits of Using a TorrentGalaxy Proxy List. Key features of the web proxy Feb 18, 2025 · Top Ranked Free Web Proxy Sites. Access updated free proxy lists with HTTP, HTTPS, SOCKS4, and SOCKS5 servers. Access from Anywhere: Proxy sites are a few options for using TorrentGalaxy in countries across the globe. Extratorrent blocked in United States, United Kingdom, Spain, Russia, France, Turkey, Pakistan, India and Italy. Moreover, they can be easily detectable by modern firewalls. This guide includes an updated list of free proxies. The 123Movies proxy site list below is updated regularly and verified by us. There are a few things that make Limetorrents a torrent. You can view all mirror and proxy sites for MagnetDL below: https://magnetdl. Perfect for scraping, testing, and bypassing restrictions. Sometimes you don't even need any proxy at all if you play nice with the website you scrape and don't make too many requests per second/minute. Use any of the mentioned VPNs to access it securely. org gives you access to download torrents for free. Mar 3, 2025 · Updated 123Movies Proxy Sites List (2025) The following table provides the latest working proxy sites for 123Movies. Most of these are working proxies, but if it doesn’t work for you, try using a different proxy site from the list below. These are 100% working 1337x proxy sites for 2025. torrentsbay. Jan 9, 2025 · Pirate Bay Proxy List; Yify Proxy List; KickAss Proxy List; RuTracker Proxy List; ExtraTorrents Proxy List; EZTV Proxy List; Zamunda Proxy List; So that’s the list of working 1337x proxy sites. Below is an updated list of reliable proxy and mirror sites: Free proxy for any device. Always choose reliable and updated proxies from trustworthy lists to enhance your streaming experience and minimize risks associated with untrusted sources. These proxies mirror the original site’s functionality, enabling users to browse and download content even if the main domain is blocked by Internet Service Providers (ISPs) or governments at TamilMV Proxy – List of 1TamilMV Proxy Sites. If the proxy or mirror sites become inaccessible, users can turn to several alternatives. Proxy List websites have more settings and a lot of Proxy Servers that you can choose from, but you must connect them manually. With multiple server locations, users can access blocked websites with minimal lag. Mar 5, 2025 · ProxySite is a free web proxy site that provides 20 US and 20 EU proxy servers. With its straightforward interface, users can unblock websites by simply entering the URL into the webpage. All proxy servers on the list are currently working, and have been tested for speed, location, and anonymity. Have a look at the best YIFY Proxy list sites that can help download YIFY torrents. Using a proxy or mirror site allows you to: Access 1337x even if the main site is prohibited. Recommended Services for Evading School Internet A list of free proxy servers from across the internet. Nov 8, 2024 · Updated List of Working Pirate Bay Proxy Sites for 2025. This is a basic list of essential features to help you make the right proxy browser choice. Aug 28, 2024 · Using FMovies proxy sites and mirror sites can be an effective way to access your favorite movies and shows when the main site is down. Of course, you can also opt for a VPN service as an alternative to a proxy site. This guide lists the 10 best free proxy servers (Top Free Proxy List), selected based on their speed, reliability, privacy features 6 days ago · 2) Smartproxy Best for automating Data Scraping. If you encounter any issues, message me directly or report the problem, and I'll remove them from the list. Access updated and reliable proxies for free today! Mar 1, 2025 · YIFY Proxy List Sites 2025. torrentbay. Feb 10, 2025 · Free Proxy List. ExtraTorrents Proxy List is a list of proxy servers designed specifically to bypass geographical and network blockades. We provide a comprehensive list of OpenVPN, HTTP, SOCKS, and V2Ray servers, all designed to help you browse the internet safely, privately, and without restrictions. This page provides a free open proxy list with public proxies scraped from many different sources. Smartproxy is an effective tool among the best proxy sites for unblocking websites online for free. Below is a detailed list of 1337x proxy and mirror sites that are operational as of January 2025. com; https://x1337x. It has a simple interface. Security Risks: Not all proxies offer encryption, potentially exposing data. Below, you’ll find our daily updated free proxy list, carefully curated to ensure reliability and performance. org; https://magnetdl. It’s important to be aware of the laws in your region before using a proxy site. Below are some working methods. Proxy Site is renowned for its quick and secure browsing experience. EZTV proxy sites are gateways and work like online VPN services. But, proxy sites don’t ensure privacy and data protection. Pirate Proxy List maintains a list of proxy sites that allow access to The Pirate Bay. We providePirate Bay proxy sites to download torrents. Free Proxy List. Many times you will run into lists flooded with cheap, free domains that offer the same level of cheap service. These mirrors will help you unblock and use the 1337x website in any region. Use it to access your favorite websites and web applications: as a Facebook or YouTube proxy. Feb 12, 2025 · While paid proxy services often provide premium features, many free proxy servers are capable of delivering secure, fast, and anonymous connections, making them a valuable option for both everyday users and gamers. ” Fill out the Proxy IP address or Proxy server name and Port in the respective boxes. Spread the loveIn an era where internet censorship and geo-restrictions are increasingly common, web proxy sites have become essential tools for accessing blocked content. Its user-friendly interface makes it a favorite among students aiming to unblock educational resources and entertainment sites. An automatically updated list of free HTTP, HTTPS, SOCKS4, and SOCKS5 proxies, available in multiple formats including JSON, TXT, CSV, XML, and YAML. This makes downloading much easier since, with a large number of active participants in the torrent network, the download speed is higher and more materials are available without waiting. We tested all of these 1337x proxy sites and all registered sites were working at the time of writing. Proxy lists, 🕵️ free list of anonymous proxy servers: HTTPS, Socks4, Socks5, txt-export ip-port and API-access — hidemy. But before choosing a service, you need to know that a proxy does not provide the anonymity to view illegal, prohibited, or other harmful sites or to commit criminal acts. What to do if the Mirror Websites or Proxies are not working? Even though, all the mirror websites listed in this post will most certainly work perfectly. Dec 20, 2024 · Locate the “Use a proxy server” option below “Manual proxy setup,” and click on “Set up. Here are a couple of our favorite proxy list providers. VPN services or, for example, Tor browser. Through these proxies, users can access restricted ExtraTorrents websites and continue to enjoy downloading and sharing torrent resources. Pros and Cons of School Proxy Websites. Established in 2003 by a Swedish anti-copyright group, Pirate Bay is a renowned file-sharing website that operates through the BitTorrent protocol. Mar 25, 2024 · Proxy sites act as an intermediary between you and the internet, routing your web traffic through a remote server and assigning you a different IP address. Proxy websites themselves can be blocked by your school, which further complicates things. Explore a list of free proxy sites for anonymous browsing, web scraping, and unlocking restricted content securely. Finding a reliable list of school-suitable proxy websites can be challenging but useful for students in need. They are an effective solution for bypassing restrictions on 1337x. Here, we'll take a look at the seven best proxy sites. These sites are maintained by volunteers and are built to resemble the original platform while ensuring uninterrupted access. Jan 14, 2025 · Best proxy sites of 2025. Mar 1, 2025 · Quick answer: The Best Anonymous Proxy Site in 2025 is Smartproxy! Most likely, you already know what an anonymous proxy is and why you need it. Faster Speeds: Some torrent proxy sites are specially optimized to enable higher download speeds than what is available at the regular (blocked) website. Unlike other online proxies, it doesn't disrupt websites and supports video and audio streaming, access to various platforms like Google and YouTube, and communication on social media. These proxies have been tested for reliability, minimal ad interference, and fast performance. https://1337x. Maintain your anonymity when using a VPN. Fresh Proxy List offers an extensive list of proxy servers with multiple sorting options, so you can choose based on your specific requirements, like speed, uptime, and ping. Mar 1, 2025 · 1337X Proxy List For 2025. One should be careful, though, as some people may be illegal in your region, so stay aware of your local regulations. It offers access to over 65 million unique IP addresses from more than 195 locations worldwide, ensuring users can navigate around restrictions easily. Discover the best free proxy server list online in 2025. Free proxy list for anonymous access on ProxyLib. Just to clarify, I don't own any of these websites. You can unblock YIFY domains and mirror sites from anywhere in the world. School proxy websites offer a quick solution for bypassing network restrictions, but like any tool, they have both benefits and drawbacks. Let's assume that you have a use case where you need residential proxies or reliable datacenter proxies, for example for scraping social media. live While proxy sites serve as intermediaries, mirror sites are identical clones of the original site. More from Featured. CroxyProxy employs advanced technology to seamlessly support modern web applications. Jan 25, 2025 · Here’s a list of working YTS proxy sites and mirrors to unblock the YIFY torrent website in any region. 🚀 Free HTTP, SOCKS4, & SOCKS5 Proxy List * Updated every 5 minutes * - proxifly/free-proxy-list Jan 25, 2025 · Here’s a list of working Pirate Bay proxy sites and mirrors. ThePirateBay. Download torrents without visiting the original domain. Plus la valeur est élevée, plus le proxy est fiable. com will connect to the website and pass it back along to you. Buy Proxy . The best Windows VPN for PC in 2025. Pro: A free anonymous web proxy service that unblocks video sites, search engines, social networks, and more. org thepiratebay10. Since 2011 ISPs in the UK, Netherland, Belgium and now France have been blocking many file sharing websites including The PirateBay. The best VPN service 2025. These domains serve as direct mirrors of the official PirateBay website, ensuring reliable access for downloading torrent files. While the temptation to use TamilMV proxy sites is strong, the risks far outweigh the benefits. Moreover, these proxy sites are tested by our team and found not banned in most countries. It is a convenient option for downloading eBooks for free. Feb 10, 2025 · The Best Proxy Websites for School. name Feb 14, 2025 · Top Free Proxy Sites in 2025. Easily download proxies in TXT, CSV, or JSON formats for secure and anonymous browsing. ninjaproxy1. It You will find sites on our proxy list that are mere minutes old! It can be very hard to find a good list of proxy sites. Enjoy unrestricted browsing! Oct 16, 2024 · Legality: In some cases, using proxy sites to bypass restrictions may be illegal. It creates an indirect connection, allowing you to access YouTube securely. Proxy List for PirateBay 2025 thepiratebay0. We do not undertake to compare these methods with the features of all existing proxy services, but CroxyProxy has several great advantages against the rest. Mar 10, 2025 · Final Thoughts. KProxy Proxy sites are the easiest methods to bypass the block. The proxy list is updated every 10 minutes to keep fresh. You can filter by port, country, anonymity, and speed, and view the list on a map. Each proxy is tested for speed, uptime, and functionality, giving you options you can trust. st; https://magnetdl. ProxySite. Feb 25, 2025 · At ultraupdates, we are sharing the best PirateBay proxy list for 2025. All your traffic is encrypted while browsing to make sure you stay anonymous. com Find and use working proxy servers for public use with this page. We frequently update and check the list of MagnetDL proxy sites below. Jan 2, 2025 · ExtraTorrents Proxy List 2025 To Unblock Extratorrent. Don’t let your boss or government block you from your favorite sites. The site has a vast number of educational audiobooks and eBook torrents. How to Use a Proxy Site. Also, the official TPB site is operational. Dec 4, 2024 · What Are TamilMV Proxy Sites? TamilMV proxy sites are intermediary platforms that allow users to bypass restrictions and access TamilMV. Best free password manager of 2025. If there are some websites you want to reach without using the proxy server, an exception list is available. Feb 11, 2025 · Using those Torlock torrent proxy and mirror sites becomes an effective but possible way to access torrents without interference. Jan 13, 2025 · How To Access and Use EZTV New Proxy Site. This proxy acts as an intermediary between your computer or gadget and the Internet. So, we need to look for something more efficient. unblockninja. When you send data to the proxy, it makes a request to the website and displays the desired content. They help you visit blocked sites in countries where they are not allowed to be accessed for legal reasons! Here is how you can use EZTV proxy sites from our list: Click on the “Visit Site” link and that will take you to the EZTV website. Mar 11, 2025 · At this time, ExtraTorrents Proxy List became the best solution to unblock this problem. ws CroxyProxy is a cutting-edge secure web proxy service. The connection is always protected. You can use it to surf anonymously by selecting any of the available proxy servers. ProxyScrape. If you are looking for the best proxy and unblocker for your school then here you are in the right place. Consider factors like speed, current status, and accessibility in your region. Below is a ranked list of our favorite proxy websites for school. com; https://magnetdl. We check them weekly and only keep the working proxy sites in the list. Below is a curated table featuring active proxy sites for accessing The Pirate Bay. They are often categorized by features such as proxy type (HTTPS, SOCK5, etc. I also liked being able to categorize proxies by three anonymity levels: low, medium, and high. Une disponibilité de 100% signifie que le proxy était disponible pour chaque requête, tandis que 50% signifie qu'il n'était disponible que la moitié du temps. Proxy servers from the free proxy list are not the only way to use sites and content out of blockages. 1. If you can't access the original site or your ISP has blocked access to one of the domains, then don't worry, you can still use the RARBG proxy server. st; https://1337x. In this article, we’ll explore the essential features users need from a proxy provider, the top use cases for proxies, and a list of the best proxy server sites for different needs. ExtraTorrent Proxy List — Unblocked ExtraTorrent Mirror Sites 2024 If you are the one who is facing a geographical restriction of the ExtraTorrent and then you landed on the right spot. These sites have been tested to ensure they provide a seamless streaming experience: Jan 31, 2025 · With so many proxy providers available, finding the best proxy service that balances speed, security, and reliability can be overwhelming. Here’s a list of some of the best unblocked proxy sites that offer free and reliable services: KProxy. Choose from updated servers to unlock secure browsing and bypass geo-restrictions with ease. HideMyAss Free Proxy. We scrape thousands of free open proxies from all over the internet and check them 24/7 to make sure you only get the freshest proxies possible. This helps hide your identity and true location to provide more private and secure web browsing. When you connect to a website through our web proxy, you aren't actually connecting to the website you're viewing. Lors des vérifications de proxy, nous envoyons plusieurs requêtes au proxy. There are several ways to access the RARBG torrent site. org pirateproxy. lbgdtffqpagwsfvselgvtitvwlkwhfapxnnwindhqftzvwdpjoslnoraalxoxlmufkeyqpsu